ULK2, Mouse, Clone: 7G5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ULK2.

Brand:  Abnova H00009706-M07.100ug

Product Code. 16171186

Description

This gene encodes a protein that is similar to a serine/threonine kinase in C. elegans which is involved in axonal elongation. The structure of this protein is similar to the C. elegans protein in that both proteins have an N-terminal kinase domain, a central proline/serine rich (PS) domain, and a C-terminal (C) domain. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq

Sequence: FLRTRTTSVGPSNSGGSLCAMSGRVCVGSPPGPGFGSSPPGAEAAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNVMLMFTECVLDL

Specifications

• Antigen: ULK2,
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC034988
• Gene Symbols: ULK2
• Immunogen: ULK2 (AAH34988, 743 a.a. ∼ 843 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG3 κ

• Applications: ELISA, Western Blot
• Clone: 7G5
• Description: Mouse monoclonal antibody raised against a partial recombinant ULK2.
• Gene: ULK2
• Gene Alias: KIAA0623/Unc51.2
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 9706
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid