ubiquitin-conjugating enzyme E2Q family member 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human UBE2Q1 protein.

Brand:  Abnova H00055585-B01.50uL

Product Code. 16161599

Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s), and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is 98% identical to the mouse counterpart. [provided by RefSeq

Sequence: MELLTKQGWSSAYSIESVIMQISATLVKGKARVQFGANKSQYSLTRAQQSYKSLVQIHEKNGWYTPPKEDG

Specifications

• Antigen: ubiquitin-conjugating enzyme E2Q family member 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human UBE2Q1 protein.
• Gene: UBE2Q1
• Gene Alias: GTAP/NICE-5/PRO3094/UBE2Q
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Ubiquitin/Proteasome
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: BC015316.1
• Gene Symbols: UBE2Q1
• Immunogen: UBE2Q1 (AAH15316.1, 1 a.a. ∼ 71 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 55585
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.