twist homolog 1 (Drosophila), Mouse, Clone: 2F8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TWIST1.

Brand:  Abnova H00007291-M03.100ug

Product Code. 16064925

Description

Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome. [provided by RefSeq

Sequence: PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH

Specifications

• Antigen: twist homolog 1 (Drosophila)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_000474
• Gene Symbols: TWIST1
• Immunogen: TWIST1 (NP_000465, 100 a.a. ∼ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 2F8
• Description: Mouse monoclonal antibody raised against a partial recombinant TWIST1.
• Gene: TWIST1
• Gene Alias: ACS3/BPES2/BPES3/SCS/TWIST/bHLHa38
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 7291
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ