tuberous sclerosis 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant TSC2.

Brand:  Abnova H00007249-A01.50uL

Product Code. 16166995

Description

Mutations in this gene lead to tuberous sclerosis complex. Its gene product is believed to be a tumor suppressor and is able to stimulate specific GTPases. The protein associates with hamartin in a cytosolic complex, possibly acting as a chaperone for hamartin. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: SPPPELEERDVAAYSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYEMLVSHIQLHYKHSYTLPIASSIRLQAFDFLFLLRADSLHRLGLPNKDGVVRFSPYCVCDYMEPERGSEKK

Specifications

• Antigen: tuberous sclerosis 2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant TSC2.
• Gene: TSC2
• Gene Alias: FLJ43106/LAM/TSC4
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Cell Cycle
• Gene ID (Entrez): 7249
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_000548
• Gene Symbols: TSC2
• Immunogen: TSC2 (NP_000539, 540 a.a. ∼ 658 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum