torsin family 3, member A, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human TOR3A protein.

Brand:  Abnova H00064222-B01.50uL

Product Code. 16173119

Description

Sequence: MLRGPWRQLWLFLLLLLPGAPEPRGASRPWEGTDEPGSAWAWPGFQRLQEQLRAAGALSKRYWTLFSCQVWPDDCDEDEEAATGPLGWRLPLLGQRYLDLLTTWYCSFKDCCPRGDCRISNNFTGLEWDLNVRLHGQHLVQQLVLRTVRGYLETPQPEKALALSFHGWSGTGKNFVARMLVENLYRDGLMSDCVRMFIATFHFPHPKYVDLYKEQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGPHLERRAPEGHRAESPWTIFLFLSNLRGDIINEVVLKLLKAGWSREEITMEHLEPHLQAEIVETIDNGFGHSRLVKENLIDYFIPFLPLEYRHVRLCARDAFLSQELLYKEETLDEIAQMMVYVPKEEQLFSSQGCKSISQRINYFLS

Specifications

• Antigen: torsin family 3, member A
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human TOR3A protein.
• Gene: TOR3A
• Gene Alias: ADIR/ADIR2/FLJ22345/MGC111104
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 64222
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_022371.2
• Gene Symbols: TOR3A
• Immunogen: TOR3A (AAH11746.1, 1 a.a. ∼ 397 a.a) full-length human protein.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum