TIMM8A, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human TIMM8A protein.

Brand:  Abnova H00001678-B01P.50ug

Product Code. 16107174

Description

This translocase is involved in the import and insertion of hydrophobic membrane proteins from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Mohr-Tranebjaerg syndrome/Deafness Dystonia Syndrome (MTS/DDS) and it is postulated that MTS/DDS is a mitochondrial disease caused by a defective mitochondrial protein import system. Defects in this gene also cause Jensen syndrome; an X-linked disease with opticoacoustic nerve atrophy and muscle weakness. This protein, along with TIMM13, forms a 70kDa heterohexamer. Alternative splicing results in multiple transcript variants encoding distinct isoforms

Sequence: MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD

Specifications

• Antigen: TIMM8A
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human TIMM8A protein.
• Gene: TIMM8A
• Gene Alias: DDP/DDP1/DFN1/MGC12262/MTS
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 1678
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Purified

• Applications: Immunofluorescence, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_004085
• Gene Symbols: TIMM8A
• Immunogen: TIMM8A (NP_004076.1, 1 a.a. ∼ 97 a.a) full-length human protein.
• Quantity: 50 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG