TGFB-induced factor homeobox 2, Mouse, Clone: 6A8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TGIF2.

Brand:  Abnova H00060436-M06.100ug

Product Code. 16139406

Description

The protein encoded by this gene is a DNA-binding homeobox protein and a transcriptional repressor. The encoded protein appears to repress transcription by recruiting histone deacetylases to TGF beta-responsive genes. This gene is amplified and overexpressed in some ovarian cancers, and mutations in this gene can cause holoprosencephaly. [provided by RefSeq

Sequence: SMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENP

Specifications

• Antigen: TGFB-induced factor homeobox 2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_021809
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 60436
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 6A8
• Description: Mouse monoclonal antibody raised against a partial recombinant TGIF2.
• Gene: TGIF2
• Gene Symbols: TGIF2
• Immunogen: TGIF2 (NP_068581, 131 a.a. ∼ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody