tektin 2 (testicular), Mouse, Clone: 2H4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TEKT2.

Brand:  Abnova H00027285-M02.100ug

Product Code. 16165826

Description

This gene product belongs to the tektin family of proteins. Tektins comprise a family of filament-forming proteins that are coassembled with tubulins to form ciliary and flagellar microtubules. This gene is expressed in the testis and its protein is localized to the flagella of the sperms, indicating that it may play a role in spermatogenesis. [provided by RefSeq

Sequence: MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKESA

Specifications

• Antigen: tektin 2 (testicular)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_014466
• Gene Symbols: TEKT2
• Immunogen: TEKT2 (NP_055281, 1 a.a. ∼ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Cell Adhesion
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 2H4
• Description: Mouse monoclonal antibody raised against a partial recombinant TEKT2.
• Gene: TEKT2
• Gene Alias: TEKTB1/TEKTIN-T/h-tektin-t
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 27285
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ