Sp1 transcription factor, Mouse, Clone: 1A5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SP1.

Brand:  Abnova H00006667-M02.100ug

Product Code. 16064745

Description

Sequence: GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQ

Specifications

• Antigen: Sp1 transcription factor
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_138473
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 6667
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 1A5
• Description: Mouse monoclonal antibody raised against a partial recombinant SP1.
• Gene: SP1
• Gene Symbols: SP1
• Immunogen: SP1 (NP_612482, 89 a.a. ∼ 198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody