SRY (sex determining region Y)-box 6, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SOX6.

Brand:  Abnova H00055553-A01.50uL

Product Code. 16168196

Description

This gene encodes a member of the D subfamily of sex determining region y-related transcription factors that are characterized by a conserved DNA-binding domain termed the high mobility group box and by their ability to bind the minor groove of DNA. The encoded protein is a transcriptional activator that is required for normal development of the central nervous system, chondrogenesis and maintenance of cardiac and skeletal muscle cells. The encoded protein interacts with other family members to cooperatively activate gene expression. Alternative splicing results in multiple transcript variants

Sequence: MSSKQATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDR

Specifications

• Antigen: SRY (sex determining region Y)-box 6
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SOX6.
• Gene: SOX6
• Gene Alias: HSSOX6
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_033326
• Gene Symbols: SOX6
• Immunogen: SOX6 (NP_201583, 1 a.a. ∼ 109 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 55553
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.