SRY (sex determining region Y)-box 30, Mouse, Clone: 6H1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SOX30.

Brand:  Abnova H00011063-M02.100ug

Product Code. 16193626

Description

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may be involved in the differentiation of developing male germ cells. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq

Sequence: SMPECLSYYEDRYPKHEGIFSTLNRDYSFRDYSSECTHSENSRSCENMNGTSYYNSHSHSGEENLNPVPQLDIGTLENVFTAPTSTPSSIQQVNVTDSDEEEEEKVLRDL

Specifications

• Antigen: SRY (sex determining region Y)-box 30
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_178424
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 11063
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 6H1
• Description: Mouse monoclonal antibody raised against a partial recombinant SOX30.
• Gene: SOX30
• Gene Symbols: SOX30
• Immunogen: SOX30 (NP_848511, 644 a.a. ∼ 753 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody