SNCG, Mouse, Clone: 2C3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SNCG.

Brand:  Abnova H00006623-M01A.200uL

Product Code. 16155595

Description

Summary: This gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development. [provided by RefSeq

Sequence: KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

Specifications

• Antigen: SNCG
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC014098
• Gene Symbols: SNCG
• Immunogen: SNCG (AAH14098, 21 a.a. ∼ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 6623
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 2C3
• Description: Mouse monoclonal antibody raised against a partial recombinant SNCG.
• Gene: SNCG
• Gene Alias: BCSG1/SR
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ