smoothened homolog (Drosophila), Mouse, Clone: 1D9, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant SMO.

Brand:  Abnova H00006608-M11.100ug

Product Code. 16155525

Description

Sequence: NLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF

Specifications

• Antigen: smoothened homolog (Drosophila)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_005631
• Gene Symbols: SMO
• Immunogen: SMO (NP_005622.1, 653 a.a. ∼ 787 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 1D9
• Description: Mouse monoclonal antibody raised against a full-length recombinant SMO.
• Gene: SMO
• Gene Alias: Gx/SMOH
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 6608
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ