SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2, Mouse, Clone: 2B2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SMARCD2.

Brand:  Abnova H00006603-M02.100ug

Product Code. 16165505

Description

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL

Specifications

• Antigen: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_003077
• Gene Symbols: SMARCD2
• Immunogen: SMARCD2 (NP_003068, 398 a.a. ∼ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 2B2
• Description: Mouse monoclonal antibody raised against a partial recombinant SMARCD2.
• Gene: SMARCD2
• Gene Alias: BAF60B/CRACD2/PRO2451/Rsc6p
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 6603
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ