secreted LY6/PLAUR domain containing 1, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human SLURP1 protein.

Brand:  Abnova H00057152-D01P.100ug

Product Code. 16182439

Description

The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. [provided by RefSeq

Sequence: MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL

Specifications

• Antigen: secreted LY6/PLAUR domain containing 1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human SLURP1 protein.
• Gene: SLURP1
• Gene Alias: ANUP/ARS/ArsB/LY6LS/MDM
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_020427
• Gene Symbols: SLURP1
• Immunogen: SLURP1 (NP_065160.1, 1 a.a. ∼ 103 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Cytokines
• Gene ID (Entrez): 57152
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG