solute carrier family 26, member 9, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SLC26A9.

Brand:  Abnova H00115019-A01.50uL

Product Code. 16191457

Description

This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures yet have markedly different tissue expression patterns. The product of this gene is a highly selective chloride ion channel regulated by WNK kinases. Alternative splicing results in multiple transcript variants encoding differing isoforms

Sequence: QTQFRNGYALAQVMDTDIYVNPKTYNRAQDIQGIKIITYCSPLYFANSEIFRQKVIAKTGMDPQKVLLAKQKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQDFENA

Specifications

• Antigen: solute carrier family 26, member 9
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SLC26A9.
• Gene: SLC26A9
• Gene Symbols: SLC26A9
• Immunogen: SLC26A9 (NP_443166, 496 a.a. ∼ 605 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_052934
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 115019
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.