SH3-domain binding protein 4, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SH3BP4.

Brand:  Abnova H00023677-A01.50uL

Product Code. 16154996

Description

This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor. [provided by RefSeq

Sequence: MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQ

Specifications

• Antigen: SH3-domain binding protein 4
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SH3BP4.
• Gene: SH3BP4
• Gene Alias: BOG25/TTP
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC057396
• Gene Symbols: SH3BP4
• Immunogen: SH3BP4 (AAH57396, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 23677
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.