SH3-domain binding protein 4, Mouse, Clone: 2B6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SH3BP4.

Brand:  Abnova H00023677-M11.100ug

Product Code. 16174996

Description

This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor. [provided by RefSeq

Sequence: MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQ

Specifications

• Antigen: SH3-domain binding protein 4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC057396
• Gene Symbols: SH3BP4
• Immunogen: SH3BP4 (AAH57396, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 2B6
• Description: Mouse monoclonal antibody raised against a partial recombinant SH3BP4.
• Gene: SH3BP4
• Gene Alias: BOG25/TTP
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 23677
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ