SH2 domain containing 3C, Mouse, Clone: 3C5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SH2D3C.

Brand:  Abnova H00010044-M07.100ug

Product Code. 16101716

Description

Sequence: MTAVGRRCPALGSRGAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKI

Specifications

• Antigen: SH2 domain containing 3C
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_005489
• Gene Symbols: SH2D3C
• Immunogen: SH2D3C (NP_005480, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 3C5
• Description: Mouse monoclonal antibody raised against a partial recombinant SH2D3C.
• Gene: SH2D3C
• Gene Alias: CHAT/FLJ39664/NSP3/PRO34088
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 10044
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ