serum/glucocorticoid regulated kinase 2, Mouse, Clone: 4G4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SGK2.

Brand:  Abnova H00010110-M05.100ug

Product Code. 16111886

Description

This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Two alternate transcripts encoding two different isoforms have been described. [provided by RefSeq

Sequence: SPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC

Specifications

• Antigen: serum/glucocorticoid regulated kinase 2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC065511
• Gene Symbols: SGK2
• Immunogen: SGK2 (AAH65511, 293 a.a. ∼ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 10110
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG3 κ

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 4G4
• Description: Mouse monoclonal antibody raised against a partial recombinant SGK2.
• Gene: SGK2
• Gene Alias: H-SGK2/dJ138B7.2
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody

Safety and Handling

Product Identifier

• SGK2 monoclonal antibody (M05), clone 4G4

Signal Word

• Warning

Hazard Category

• Acute toxicity Category 4
• Serious eye damage/eye irritation Category 2
• Skin corrosion/irritation Category 2

Hazard Statement

• H302-Harmful if swallowed.
• H315-Causes skin irritation.
• H319-Causes serious eye irritation.

Precautionary Statement

• P102-Keep out of reach of children.
• P103-Read label before use.
• P233-Keep container tightly closed.
• P264-Wash hands thoroughly after handling.
• P270-Do not eat, drink or smoke when using this product.
• P280-Wear protective gloves/protective clothing/eye protection/face protection.
• P301+P310-IF SWALLOWED: Immediately call a POISON CENTER/doctor /
• P303+P361+P353-IF ON SKIN (or hair): Take off immediately all contaminated clothing. Rinse skin with water/ shower.
• P305+P351+P338-IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
• P404-Store in a closed container.
• P501b-Dispose of contents/container in accordance with local/regional/national/international regulations.

Supplemental information

• MIXTURE LIST-Contains : sodium phosphate dibasic, potassium phosphate monobasic