secreted frizzled-related protein 4, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SFRP4.

Brand:  Abnova H00006424-A01.50uL

Product Code. 16105125

Description

Secreted frizzled-related protein 4 (SFRP4) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. The expression of SFRP4 in ventricular myocardium correlates with apoptosis related gene expression. [provided by RefSeq

Sequence: CNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSN

Specifications

• Antigen: secreted frizzled-related protein 4
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SFRP4.
• Gene: SFRP4
• Gene Alias: FRP-4/FRPHE/MGC26498
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_003014.2
• Gene Symbols: SFRP4
• Immunogen: SFRP4 (NP_003005.1, 211 a.a. ∼ 312 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 6424
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.