septin 11, Mouse, Clone: 1E5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SEPT11.

Brand:  Abnova H00055752-M02.100ug

Product Code. 16148346

Description

SEPT11 belongs to the conserved septin family of filament-forming cytoskeletal GTPases that are involved in a variety of cellular functions including cytokinesis and vesicle trafficking (Hanai et al., 2004 [PubMed 15196925]; Nagata et al., 2004 [PubMed 15485874]).[supplied by OMIM

Sequence: LRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYID

Specifications

• Antigen: Septin-11
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC008083
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 55752
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b λ

• Applications: ELISA, Western Blot
• Clone: 1E5
• Description: Mouse monoclonal antibody raised against a partial recombinant SEPT11.
• Gene: SEPT11
• Gene Symbols: SEPT11
• Immunogen: SEPT11 (AAH08083, 71 a.a. ∼ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody