SEMA4A, Mouse, Clone: 4E2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SEMA4A.

Brand:  Abnova H00064218-M02.100ug

Product Code. 16193483

Description

SEMA4A is a member of the semaphorin family of soluble and transmembrane proteins. Semaphorins are involved in guidance of axonal migration during neuronal development and in immune responses.[supplied by OMIM

Sequence: GGGQGPMPRVRYYAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLV

Specifications

• Antigen: SEMA4A
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_022367
• Gene Symbols: SEMA4A
• Immunogen: SEMA4A (NP_071762, 33 a.a. ∼ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA
• Clone: 4E2
• Description: Mouse monoclonal antibody raised against a partial recombinant SEMA4A.
• Gene: SEMA4A
• Gene Alias: CORD10/FLJ12287/RP35/SEMAB/SEMB
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 64218
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid