missing translation for 'onlineSavingsMsg'
Learn More

SEMA4A, Mouse, Clone: 4E2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SEMA4A.

Brand:  Abnova H00064218-M02.100ug

Additional Details : Weight : 0.00010kg

Product Code. 16193483

  • £289.88 / 100µg

Estimated Shipment
22-06-2020

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: GGGQGPMPRVRYYAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLV
Specifications

Specifications

SEMA4A
Monoclonal
Unconjugated
PBS with no preservative; pH 7.4
NM_022367
CORD10|FLJ12287|RP35|SEMAB|SEMB
Mouse
IgG2a Kappa
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
64218
ELISA
4E2
Mouse monoclonal antibody raised against a partial recombinant SEMA4A.
SEMA4A
Liquid
SEMA4A
SEMA4A (NP_071762, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Affinity chromatography
RUO
Antibody
Monoclonal
Human
Videos
Documents