secretogranin II (chromogranin C), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SCG2.

Brand:  Abnova H00007857-A01.50uL

Product Code. 16178015

Description

The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown. [provided by RefSeq

Sequence: LARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM

Specifications

• Antigen: secretogranin II (chromogranin C)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SCG2.
• Gene: SCG2
• Gene Alias: CHGC/SN/SgII
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Angiogenesis
• Gene ID (Entrez): 7857
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_003469
• Gene Symbols: SCG2
• Immunogen: SCG2 (NP_003460, 508 a.a. ∼ 617 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum