reticulon 3, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human RTN3 protein.

Brand:  Abnova H00010313-B01P.50ug

Product Code. 16152336

Description

The reticulons are a group of highly conserved genes with preferential expression in neuroendocrine tissues (see, e.g., RTN1; MIM 600865).[supplied by OMIM

Sequence: MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE

Specifications

• Antigen: reticulon 3
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human RTN3 protein.
• Gene: RTN3
• Gene Alias: ASYIP/HAP/NSPL2/NSPLII/RTN3-A1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_006054.2
• Gene Symbols: RTN3
• Immunogen: RTN3 (NP_006045.1, 1 a.a. ∼ 236 a.a) full-length human protein.
• Quantity: 50 μg
• Research Discipline: Apoptosis
• Gene ID (Entrez): 10313
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG