rhotekin, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant RTKN.

Brand:  Abnova H00006242-A01.50uL

Product Code. 16134795

Description

This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: VTDILTQREGARLETPPPWLAMFTDQPALPNPCSPASVAPAPDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPPQRSPRTRGLCSKGQPRTWLQSP

Specifications

• Antigen: rhotekin
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant RTKN.
• Gene: RTKN
• Gene Symbols: RTKN
• Immunogen: RTKN (NP_149035, 451 a.a. ∼ 549 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 6242
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_033046
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Apoptosis
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum