ring finger protein 14, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human RNF14 protein.

Brand:  Abnova H00009604-B01.50uL

Product Code. 16136108

Description

The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Five alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq

Sequence: MQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED

Specifications

• Antigen: ring finger protein 14
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human RNF14 protein.
• Gene: RNF14
• Gene Alias: ARA54/FLJ26004/HFB30/HRIHFB2038/TRIAD2
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: Immunofluorescence, Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_183398.1
• Gene Symbols: RNF14
• Immunogen: RNF14 (NP_899645.1, 1 a.a. ∼ 348 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 9604
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.