ring finger protein 135, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human RNF135 protein.

Brand:  Abnova H00084282-B01.50uL

Product Code. 16160707

Description

The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq

Sequence: MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKENSWKPRLPPHAHCLTRATLHSGELLGLLSGPSIQPLT

Specifications

• Antigen: ring finger protein 135
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human RNF135 protein.
• Gene: RNF135
• Gene Alias: L13/MGC13061/Riplet
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 84282
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_197939.1
• Gene Symbols: RNF135
• Immunogen: RNF135 (NP_922921.1, 1 a.a. ∼ 210 a.a) full-length human protein.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum