ring finger protein 11, Mouse, Clone: 4G7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RNF11.

Brand:  Abnova H00026994-M01.100ug

Product Code. 16155606

Description

The protein encoded by this gene contains a RING-H2 finger motif, which is known to be important for protein-protein interactions. The expression of this gene has been shown to be induced by mutant RET proteins (MEN2A/MEN2B). The germline mutations in RET gene are known to be responsible for the development of multiple endocrine neoplasia (MEN). [provided by RefSeq

Sequence: EEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN

Specifications

• Antigen: ring finger protein 11
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_014372
• Gene Symbols: RNF11
• Immunogen: RNF11 (NP_055187, 65 a.a. ∼ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 4G7
• Description: Mouse monoclonal antibody raised against a partial recombinant RNF11.
• Gene: RNF11
• Gene Alias: CGI-123/MGC51169/SID1669
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26994
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ