replication factor C (activator 1) 1, 145kDa, Mouse, Clone: 3F8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RFC1.

Brand:  Abnova H00005981-M01.100ug

Product Code. 16154275

Description

The protein encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability. [provided by RefSeq]

Sequence: MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISET

Specifications

• Antigen: replication factor C (activator 1) 1, 145kDa
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC051786
• Gene Symbols: RFC1
• Immunogen: RFC1 (AAH51786, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 3F8
• Description: Mouse monoclonal antibody raised against a partial recombinant RFC1.
• Gene: RFC1
• Gene Alias: A1/MGC51786/MHCBFB/PO-GA/RECC1/RFC/RFC140
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5981
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG3 κ