CGRP receptor component, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant RCP9.

Brand:  Abnova H00027297-A01.50uL

Product Code. 16155846

Description

This gene encodes a membrane protein that functions as part of a receptor complex for a small neuropeptide that increases intracellular cAMP levels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: QQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA

Specifications

• Antigen: CGRP receptor component
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant RCP9.
• Gene: CRCP
• Gene Alias: CGRP-RCP/MGC111194/RCP/RCP9
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_014478
• Gene Symbols: CRCP
• Immunogen: RCP9 (NP_055293, 39 a.a. ∼ 148 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 27297
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.