Ral GEF with PH domain and SH3 binding motif 2, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human RALGPS2 protein.

Brand:  Abnova H00055103-D01P.100ug

Product Code. 16177886

Description

Sequence: MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTPEEYAGQITLMDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEVLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKEDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDIPMLPHVQKYLNSVQYIEELQKFVEDDNYK

Specifications

• Antigen: Ral GEF with PH domain and SH3 binding motif 2
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human RALGPS2 protein.
• Gene: RALGPS2
• Gene Alias: FLJ10244/FLJ25604/KIAA0351/dJ595C2.1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_018037
• Gene Symbols: RALGPS2
• Immunogen: RALGPS2 (NP_060507.1, 1 a.a. ∼ 279 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 55103
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG