Rab acceptor 1 (prenylated), Mouse, Clone: 2A4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RABAC1.

Brand:  Abnova H00010567-M01.100ug

Product Code. 16122816

Description

Sequence: MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRPRNLGELCQRLVRNVEYYQSN

Specifications

• Antigen: Rab acceptor 1 (prenylated)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_006423
• Gene Symbols: RABAC1
• Immunogen: RABAC1 (NP_006414.1, 1 a.a. ∼ 77 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 2A4
• Description: Mouse monoclonal antibody raised against a partial recombinant RABAC1.
• Gene: RABAC1
• Gene Alias: PRA1/PRAF1/YIP3
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10567
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ