pancreas specific transcription factor, 1a, Mouse, Clone: 1A2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PTF1A.

Brand:  Abnova H00256297-M05.100ug

Product Code. 16109713

Description

This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. [provided by RefSeq

Sequence: QAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS

Specifications

• Antigen: pancreas specific transcription factor, 1a
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_178161
• Gene Symbols: PTF1A
• Immunogen: PTF1A (NP_835455, 250 a.a. ∼ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 256297
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 1A2
• Description: Mouse monoclonal antibody raised against a partial recombinant PTF1A.
• Gene: PTF1A
• Gene Alias: PTF1-p48/bHLHa29
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

Safety and Handling

Product Identifier

• PTF1A monoclonal antibody (M05), clone 1A2

Signal Word

• Warning

Hazard Category

• Acute toxicity Category 4
• Serious eye damage/eye irritation Category 2
• Skin corrosion/irritation Category 2

Hazard Statement

• H302-Harmful if swallowed.
• H315-Causes skin irritation.
• H319-Causes serious eye irritation.

Precautionary Statement

• P102-Keep out of reach of children.
• P103-Read label before use.
• P233-Keep container tightly closed.
• P264-Wash thoroughly after handling.
• P270-Do not eat, drink or smoke when using this product.
• P280-Wear protective gloves/protective clothing/eye protection/face protection.
• P301+P310-IF SWALLOWED: Immediately call a POISON CENTER/doctor /
• P303+P361+P353-IF ON SKIN (or hair): Take off immediately all contaminated clothing. Rinse skin with water/ shower.
• P305+P351+P338-IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
• P404-Store in a closed container.
• P501b-Dispose of contents/container in accordance with local/regional/national/international regulations.

Supplemental information

• MIXTURE LIST-Contains : sodium phosphate dibasic, potassium phosphate monobasic