missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16109713

pancreas specific transcription factor, 1a, Mouse, Clone: 1A2, Abnova™

Product Code. 16109713
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16109713 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16109713 Supplier Abnova Supplier No. H00256297M05.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse monoclonal antibody raised against a partial recombinant PTF1A.

This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. [provided by RefSeq

Sequence: QAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS

Specifications

Antigen pancreas specific transcription factor, 1a
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 1A2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PTF1A.
Formulation PBS with no preservative; pH 7.4
Gene PTF1A
Gene Accession No. NM_178161
Gene Alias PTF1-p48/bHLHa29
Gene Symbols PTF1A
Host Species Mouse
Immunogen PTF1A (NP_835455, 250 a.a. ∼ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 256297
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a
Show More Show Less

Safety and Handling

compliance-icons
Product Identifier
  • PTF1A monoclonal antibody (M05), clone 1A2
 Signal Word
  • Warning
 Hazard Category
  • Acute toxicity Category 4
  • Serious eye damage/eye irritation Category 2
  • Skin corrosion/irritation Category 2
 Hazard Statement
  • H302-Harmful if swallowed.
  • H315-Causes skin irritation.
  • H319-Causes serious eye irritation.
 Precautionary Statement
  • P102-Keep out of reach of children.
  • P103-Read label before use.
  • P233-Keep container tightly closed.
  • P264-Wash thoroughly after handling.
  • P270-Do not eat, drink or smoke when using this product.
  • P280-Wear protective gloves/protective clothing/eye protection/face protection.
  • P301+P310-IF SWALLOWED: Immediately call a POISON CENTER/doctor /
  • P303+P361+P353-IF ON SKIN (or hair): Take off immediately all contaminated clothing. Rinse skin with water/ shower.
  • P305+P351+P338-IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
  • P404-Store in a closed container.
  • P501b-Dispose of contents/container in accordance with local/regional/national/international regulations.
 Supplemental information
  • MIXTURE LIST-Contain: sodium phosphate dibasic, potassium phosphate monobasic
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.