protein kinase C, epsilon, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PRKCE.

Brand:  Abnova H00005581-A01.50uL

Product Code. 16103335

Description

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been shown to be involved in many different cellular functions, such as neuron channel activation, apoptosis, cardioprotection from ischemia, heat shock response, as well as insulin exocytosis. Knockout studies in mice suggest that this kinase is important for lipopolysaccharide (LPS)-mediated signaling in activated macrophages and may also play a role in controlling anxiety-like behavior. [provided by RefSeq

Sequence: KVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQA

Specifications

• Antigen: protein kinase C, epsilon
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant PRKCE.
• Gene: PRKCE
• Gene Alias: MGC125656/MGC125657/PKCE/nPKC-epsilon
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Apoptosis
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_005400
• Gene Symbols: PRKCE
• Immunogen: PRKCE (NP_005391, 301 a.a. ∼ 400 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 5581
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.