phosphodiesterase 1B, calmodulin-dependent, Mouse, Clone: 4F9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PDE1B.

Brand:  Abnova H00005153-M02.100ug

Product Code. 16122545

Description

Sequence: TDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD

Specifications

• Antigen: phosphodiesterase 1B, calmodulin-dependent
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC032226
• Gene Symbols: PDE1B
• Immunogen: PDE1B (AAH32226, 437 a.a. ∼ 536 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Apoptosis
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 4F9
• Description: Mouse monoclonal antibody raised against a partial recombinant PDE1B.
• Gene: PDE1B
• Gene Alias: PDE1B1/PDES1B
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 5153
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG3 κ