phosphate cytidylyltransferase 1, choline, beta, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PCYT1B.

Brand:  Abnova H00009468-A01.50uL

Product Code. 16180736

Description

The protein encoded by this gene belongs to the cytidylyltransferase family. It is involved in the regulation of phosphatidylcholine biosynthesis. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: NEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQAL

Specifications

• Antigen: phosphate cytidylyltransferase 1, choline, beta
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant PCYT1B.
• Gene: PCYT1B
• Gene Alias: CCT-beta/CTB
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 9468
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004845
• Gene Symbols: PCYT1B
• Immunogen: PCYT1B (NP_004836, 236 a.a. ∼ 314 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum