PCTAIRE protein kinase 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PCTK2.

Brand:  Abnova H00005128-A01.50uL

Product Code. 16014515

Description

The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It has similarity to rat protein which is thought to play a role in terminally differentiated neurons. [provided by RefSeq

Sequence: NFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF

Specifications

• Antigen: PCTAIRE protein kinase 2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant PCTK2.
• Gene: PCTK2
• Gene Alias: PCTAIRE2
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_002595
• Gene Symbols: PCTK2
• Immunogen: PCTK2 (NP_002586, 426 a.a. ∼ 523 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 5128
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.