pre-B-cell leukemia homeobox 3, Mouse, Clone: 1A11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PBX3.

Brand:  Abnova H00005090-M02.100ug

Product Code. 16172405

Description

Sequence: FNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN

Specifications

• Antigen: pre-B-cell leukemia homeobox 3
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_006195
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 5090
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 1A11
• Description: Mouse monoclonal antibody raised against a partial recombinant PBX3.
• Gene: PBX3
• Gene Symbols: PBX3
• Immunogen: PBX3 (NP_006186, 342 a.a. ∼ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody