peptidyl arginine deiminase, type IV, Mouse, Clone: 4D8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PADI4.

Brand:  Abnova H00023569-M01.100ug

Product Code. 16114856

Description

This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. [provided by RefSeq]

Sequence: AQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYL

Specifications

• Antigen: peptidyl arginine deiminase, type IV
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_012387
• Gene Symbols: PADI4
• Immunogen: PADI4 (NP_004247, 2 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 4D8
• Description: Mouse monoclonal antibody raised against a partial recombinant PADI4.
• Gene: PADI4
• Gene Alias: PAD/PAD4/PADI5/PDI4/PDI5
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23569
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ