nudix (nucleoside diphosphate linked moiety X)-type motif 2, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human NUDT2 protein.

Brand:  Abnova H00000318-D01P

Product Code. 16104714

Description

This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and three transcript variants, all encoding the same protein, have been identified. [provided by RefSeq

Sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA

Specifications

• Antigen: nudix (nucleoside diphosphate linked moiety X)-type motif 2
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human NUDT2 protein.
• Gene: NUDT2
• Gene Alias: APAH1/MGC10404
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001161
• Gene Symbols: NUDT2
• Immunogen: NUDT2 (NP_001152.1, 1 a.a. ∼ 147 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Apoptosis
• Gene ID (Entrez): 318
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG