NAD(P) dependent steroid dehydrogenase-like, Mouse, Clone: 6E3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NSDHL.

Brand:  Abnova H00050814-M01.100ug

Product Code. 16176446

Description

The protein encoded by this gene is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in this gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males. Alternatively spliced transcript variants with differing 5' UTR have been found for this gene. [provided by RefSeq]

Sequence: MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQNQAKRCTVIGGSGFLGQHMVEQLLARGYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCASPPPS

Specifications

• Antigen: NAD(P) dependent steroid dehydrogenase-like
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_015922
• Gene Symbols: NSDHL
• Immunogen: NSDHL (NP_057006, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 6E3
• Description: Mouse monoclonal antibody raised against a partial recombinant NSDHL.
• Gene: NSDHL
• Gene Alias: H105E3/SDR31E1/XAP104
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 50814
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ