neuromedin U (B02P), Mouse anti-Human, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human NMU protein.

Brand:  Abnova H00010874-B02P.50ug

Product Code. 16143296

Description

Sequence: MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI

Specifications

• Antigen: neuromedin U
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human NMU protein.
• Gene: NMU
• Gene Symbols: NMU
• Immunogen: NMU (NP_006672, 1 a.a. ∼ 174 a.a) full-length human protein.
• Quantity: 50 μg
• Research Discipline: Neurobiology
• Gene ID (Entrez): 10874
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_006681
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody