nonmetastatic cells 1, protein (NM23A) expressed in, Mouse, Clone: 1D7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NME1.

Brand:  Abnova H00004830-M02.100ug

Product Code. 16131955

Description

This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq]

Sequence: ASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

Specifications

• Antigen: non-metastatic cells 1, protein (NM23A) expressed in
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_000269
• Gene Symbols: NME1
• Immunogen: NME1 (NP_000260, 43 a.a. ∼ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Endocrine/Metabolism
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
• Clone: 1D7
• Description: Mouse monoclonal antibody raised against a partial recombinant NME1.
• Gene: NME1
• Gene Alias: AWD/GAAD/NB/NBS/NDPK-A/NDPKA/NM23/NM23-H1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 4830
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ