nemo-like kinase, Mouse, Clone: 2B11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NLK.

Brand:  Abnova H00051701-M02.100ug

Product Code. 16177226

Description

Sequence: DEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE

Specifications

• Antigen: nemo-like kinase
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC064663
• Gene Symbols: NLK
• Immunogen: NLK (AAH64663, 416 a.a. ∼ 515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody

• Applications: ELISA, In situ PLA, Western Blot
• Clone: 2B11
• Description: Mouse monoclonal antibody raised against a partial recombinant NLK.
• Gene: NLK
• Gene Alias: DKFZp761G1211/FLJ21033
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 51701
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ