neurogenic differentiation 1, Mouse, Clone: 3H8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NEUROD1.

Brand:  Abnova H00004760-M01.100ug

Product Code. 16141845

Description

This gene encodes a member of the NeuroD family of basic helix-loop-helix (bHLH) transcription factors. The protein forms heterodimers with other bHLH proteins and activates transcription of genes that contain a specific DNA sequence known as the E-box. It regulates expression of the insulin gene, and mutations in this gene result in type II diabetes mellitus. [provided by RefSeq

Sequence: QDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT

Specifications

• Antigen: neurogenic differentiation 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC009046
• Gene Symbols: NEUROD1
• Immunogen: NEUROD1 (AAH09046, 201 a.a. ∼ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Neurobiology
• Gene ID (Entrez): 4760
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 3H8
• Description: Mouse monoclonal antibody raised against a partial recombinant NEUROD1.
• Gene: NEUROD1
• Gene Alias: BETA2/BHF-1/NEUROD/bHLHa3
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody