nuclear prelamin A recognition factor, Mouse, Clone: 7D9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NARF.

Brand:  Abnova H00026502-M03A.200uL

Product Code. 16105506

Description

Several proteins have been found to be prenylated and methylated at their carboxyl-terminal ends. Prenylation was initially believed to be important only for membrane attachment. However, another role for prenylation appears to be its importance in protein-protein interactions. The only nuclear proteins known to be prenylated in mammalian cells are prelamin A- and B-type lamins. Prelamin A is farnesylated and carboxymethylated on the cysteine residue of a carboxyl-terminal CaaX motif. This post-translationally modified cysteine residue is removed from prelamin A when it is endoproteolytically processed into mature lamin A. The protein encoded by this gene binds to the prenylated prelamin A carboxyl-terminal tail domain. It may be a component of a prelamin A endoprotease complex. The encoded protein is located in the nucleus, where it partially colocalizes with the nuclear lamina. It shares limited sequence similarity with iron-only bacterial hydrogenases. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene, including one with a novel exon that is generated by RNA editing. [provided by RefSeq

Sequence: MKCEHCTRKECSKKTKTDDQENVSADAPSPAQENGEKGEFHKLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKDFFRVLNLNKKCDTSKHKVLVVSVCP

Specifications

• Antigen: nuclear prelamin A recognition factor
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_031968
• Gene Symbols: NARF
• Immunogen: NARF (NP_114174, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM κ

• Applications: ELISA, Western Blot
• Clone: 7D9
• Description: Mouse monoclonal antibody raised against a partial recombinant NARF.
• Gene: NARF
• Gene Alias: DKFZp434G0420/FLJ10067/IOP2
• Host Species: Mouse
• Quantity: 200 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 26502
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites