myelin transcription factor 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MYT1.

Brand:  Abnova H00004661-A01.50uL

Product Code. 16121635

Description

The protein encoded by this gene is a member of a family of neural specific, zinc finger-containing DNA-binding proteins. The protein binds to the promoter regions of proteolipid proteins of the central nervous system and plays a role in the developing nervous system. [provided by RefSeq

Sequence: DYASFDAQVFGKRMLAPKIQTSETSPKAFQCFDYSQDAEAAHMAATAILNLSTRCWEMPENLSTKPQDLPSKSVDIEVDENGTLDLSMHKHRKRENAFPS

Specifications

• Antigen: myelin transcription factor 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant MYT1.
• Gene: MYT1
• Gene Alias: C20orf36/MTF1/MYTI/PLPB1
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004535
• Gene Symbols: MYT1
• Immunogen: MYT1 (NP_004526, 586 a.a. ∼ 685 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 4661
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.