mitochondrial ribosomal protein S27, Mouse, Clone: 3G8, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant MRPS27.

Brand:  Abnova H00023107-M14A.200uL

Product Code. 16166952

Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that may be a functional partner of the death associated protein 3 (DAP3). [provided by RefSeq

Sequence: SEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA

Specifications

• Antigen: mitochondrial ribosomal protein S27
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC030521
• Gene Symbols: MRPS27
• Immunogen: MRPS27 (AAH30521, 51 a.a. ∼ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 23107
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 3G8
• Description: Mouse monoclonal antibody raised against a full length recombinant MRPS27.
• Gene: MRPS27
• Gene Alias: FLJ21764/FLJ23348/KIAA0264/MRP-S27/S27mt
• Host Species: Mouse
• Quantity: 200 μL
• Research Discipline: Stem Cell Biology
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM κ