membrane frizzled-related protein, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MFRP.

Brand:  Abnova H00083552-A01.50uL

Product Code. 16120487

Description

This gene encodes a member of the frizzled-related proteins. The encoded protein may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen. The protein is encoded by a bicistronic mRNA, which also encodes C1q and tumor necrosis factor related protein 5

Sequence: NTTAFPNIWVGMITQEEVVEVLSGYKSLTSLPCYQHFRRLLCGLLVPRCTPLGSVLPPCRSVCQEAEHQCQSGLALLGTPWPFNCNRLPEAADLEACAQP

Specifications

• Antigen: membrane frizzled-related protein
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant MFRP.
• Gene: MFRP
• Gene Alias: C1QTNF5/FLJ30570/NNO2/rd6
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_031433
• Gene Symbols: MFRP
• Immunogen: MFRP (NP_113621, 480 a.a. ∼ 579 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 83552
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.